Web stats for Modernfamilynightlysweepstakes - modernfamilynightlysweepstakes.com
Win an Awesome TV and Home Theater System courtesy of Modern Family Nightly!
1.67 Rating by ClearWebStats
modernfamilynightlysweepstakes.com is 9 years 9 months 1 week old. This website has a #1,654,779 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, modernfamilynightlysweepstakes.com is SAFE to browse.
Traffic Report of Modernfamilynightlysweepstakes
| Daily Unique Visitors: | 291 |
| Daily Pageviews: | 582 |
Estimated Valuation
| Income Per Day: | $ 2.00 |
| Estimated Worth: | $ 480.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | 9 |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | 1,654,779 |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
79
Siteadvisor Rating
Not Applicable
Where is modernfamilynightlysweepstakes.com server located?
Hosted IP Address:
98.129.229.197
Hosted Country:
US
Location Latitude:
42.7348Location Longitude:
-84.6245Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | 36 |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 4 |
| Google Adsense: | Not Applicable | Google Analytics: | UA-31504323-13 |
Websites Hosted on Same IP (i.e. 98.129.229.197)
2014 Teen Choice Awards - August 10, 2014 - Vote Every Day
369,758 
$ 14,040.00
THE INDEPENDENT FAMILY OF PUBLICATIONS FROM INTER PRESS SERVICE
Not Applicable $ 8.95
HRIS, payroll services, HR software, recruiting software | Ascentis
Ascentis human resources management software and online payroll processing services are easy to set up, use, and are fully backed by friendly customer support professionals.
263,470 $ 19,440.00
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Microsoft-IIS/7.5
Vary: Accept-Encoding
X-AspNet-Version: 4.0.30319
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Date: Wed, 19 Nov 2014 18:06:22 GMT
X-Powered-By: ASP.NET
Content-Length: 1638
Status-Code: 200
Status: 200 OK
Server: Microsoft-IIS/7.5
Vary: Accept-Encoding
X-AspNet-Version: 4.0.30319
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Date: Wed, 19 Nov 2014 18:06:22 GMT
X-Powered-By: ASP.NET
Content-Length: 1638
Domain Information for modernfamilynightlysweepstakes.com
| Domain Registrar: |
GODADDY.COM, LLC
|
|---|---|
| Registration Date: | 2014-08-08 9 years 9 months 1 week ago |
| Last Modified: | 2014-08-08 9 years 9 months 1 week ago |
| Expiration Date: | 2015-08-08 8 years 9 months 1 week ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| dns1.stabletransit.com |
|
69.20.95.4 |
United States
|
| dns2.stabletransit.com |
|
65.61.188.4 |
United States
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| modernfamilynightlysweepstakes.com | A | 3599 |
IP:98.129.229.197 |
| modernfamilynightlysweepstakes.com | NS | 3599 |
Target:dns1.stabletransit.com |
| modernfamilynightlysweepstakes.com | NS | 3599 |
Target:dns2.stabletransit.com |
| modernfamilynightlysweepstakes.com | SOA | 3599 |
MNAME:dns1.stabletransit.com RNAME:ipadmin.stabletransit.com Serial:1407539103 Refresh:3600 Retry:300 Expire:1814400 |
| modernfamilynightlysweepstakes.com | MX | 3599 |
Priority:10 Target:mx1.emailsrvr.com |
| modernfamilynightlysweepstakes.com | MX | 3599 |
Priority:20 Target:mx2.emailsrvr.com |
Similarly Ranked Websites to Modernfamilynightlysweepstakes
Internetagentur Comwrap - Agentur für digitale Medien
Als Internetagentur entwickelt comwrap Online-Shops, Websites und Communities, Kampagnen für Internet und Mobile. Internetagentur Comwrap - belebt Ihr Geschäft!
1,654,780 $ 480.00
Артель - управление молодежной политики МГУПС (МИИТ)
Официальный сайт управления молодежной политики МГУПС (МИИТ)
1,654,784 $ 480.00